Id: | acc4768 |
Group: | 1sens |
Protein: | p38 MAPK |
Gene Symbol: | Mapk14 |
Protein Id: | P47811 |
Protein Name: | MK14_MOUSE |
PTM: | phosphorylation |
Site: | Thr180 |
Site Sequence: | LARHTDDEMTGYVATRWYRAP |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Cardiomyopathy |
Disease Subtype: | septic cardiomyopathy |
Disease Cellline: | |
Disease Info: | |
Drug: | Hydrogen therapy |
Drug Info: | "Hydrogen therapy is a treatment approach that involves the use of molecular hydrogen. It is thought to exert antioxidant, anti - inflammatory, and anti - apoptotic effects through various biological mechanisms. " |
Relation: |
Hydrogen therapy
➜
p38 MAPK-Thr180
DOWN
➜
Cardiomyopathy
Alleviate
|
Effect: | modulate |
Effect Info: | "Hydrogen can significantly inhibit the phosphorylation of p38, reduce the levels of inflammatory factors such as TNFalpha and IL-1beta in myocardial tissue, and participate in the anti-inflammatory protection of lipopolysaccharide (LPS)-induced septic cardiomyopathy." |
Note: | Non-conventional drugs |
Score: | 3.0 |
Pubmed(PMID): | 31440160 |
Sentence Index: | 31440160_13 |
Sentence: | "Furthermore, pretreatment with hydrogen resulted in cardioprotection during septic cardiomyopathy via inhibiting the expression of pro-inflammatory cytokines TNFalpha, IL-1beta, and IL-18; suppressing the phosphorylation of ERK1/2, p38, and JNK; and reducing the nuclear translocation of NF-kappaB and the expression of TLR4 by LPS." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.