Id: acc4768
Group: 1sens
Protein: p38 MAPK
Gene Symbol: Mapk14
Protein Id: P47811
Protein Name: MK14_MOUSE
PTM: phosphorylation
Site: Thr180
Site Sequence: LARHTDDEMTGYVATRWYRAP
Disease Category: Cardiovascular and circulatory system diseases
Disease: Cardiomyopathy
Disease Subtype: septic cardiomyopathy
Disease Cellline:
Disease Info:
Drug: Hydrogen therapy
Drug Info: "Hydrogen therapy is a treatment approach that involves the use of molecular hydrogen. It is thought to exert antioxidant, anti - inflammatory, and anti - apoptotic effects through various biological mechanisms. "
Relation:
Hydrogen therapy
p38 MAPK-Thr180 DOWN
Cardiomyopathy Alleviate
Effect: modulate
Effect Info: "Hydrogen can significantly inhibit the phosphorylation of p38, reduce the levels of inflammatory factors such as TNFalpha and IL-1beta in myocardial tissue, and participate in the anti-inflammatory protection of lipopolysaccharide (LPS)-induced septic cardiomyopathy."
Note: Non-conventional drugs
Score: 3.0
Pubmed(PMID): 31440160
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: