Id: | acc4762 |
Group: | 1sens |
Protein: | PP2A |
Gene Symbol: | Ppp2ca |
Protein Id: | P63330 |
Protein Name: | PP2AA_MOUSE |
PTM: | methylation |
Site: | Leu309 |
Site Sequence: | VTRRTPDYFL----------- |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Cardiac Dysfunction |
Disease Subtype: | Sepsis-Associated Cardiac Dysfunction |
Disease Cellline: | |
Disease Info: | |
Drug: | LPS |
Drug Info: | "LPS (Lipopolysaccharide) is a major component of the outer membrane of Gram - negative bacteria, which can trigger a strong immune response in the host organism." |
Relation: |
LPS
➜
PP2A-Leu309
DOWN
➜
Cardiac Dysfunction
Aggravate
|
Effect: | modulate |
Effect Info: | "LPS treatment decreased the expression of the catalytic subunit and the B56alpha regulatory subunit of PP2A and increased its demethylated form, resulting in a decrease in PP2A activity and indirectly enhancing cTnI phosphorylation and the inhibitory effect on cardiac function." |
Note: | inducer |
Score: | 3.0 |
Pubmed(PMID): | 19201758 |
Sentence Index: | 19201758_1 |
Sentence: | AIMS: Sepsis-associated cardiac dysfunction represents an intrinsic impairment of cardiomyocyte function due in part to a decrease in myofilament Ca(2+) sensitivity associated with a sustained increase in cardiac troponin I (cTnI) phosphorylation at Ser23/24. |
Sequence & Structure:
MDEKLFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.