Id: acc4762
Group: 1sens
Protein: PP2A
Gene Symbol: Ppp2ca
Protein Id: P63330
Protein Name: PP2AA_MOUSE
PTM: methylation
Site: Leu309
Site Sequence: VTRRTPDYFL-----------
Disease Category: Cardiovascular and circulatory system diseases
Disease: Cardiac Dysfunction
Disease Subtype: Sepsis-Associated Cardiac Dysfunction
Disease Cellline:
Disease Info:
Drug: LPS
Drug Info: "LPS (Lipopolysaccharide) is a major component of the outer membrane of Gram - negative bacteria, which can trigger a strong immune response in the host organism."
Relation:
LPS
PP2A-Leu309 DOWN
Cardiac Dysfunction Aggravate
Effect: modulate
Effect Info: "LPS treatment decreased the expression of the catalytic subunit and the B56alpha regulatory subunit of PP2A and increased its demethylated form, resulting in a decrease in PP2A activity and indirectly enhancing cTnI phosphorylation and the inhibitory effect on cardiac function."
Note: inducer
Score: 3.0
Pubmed(PMID): 19201758
Sentence Index:
Sentence:

Sequence & Structure:

MDEKLFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: