Id: | acc4759 |
Group: | 1sens |
Protein: | Histone H4 |
Gene Symbol: | H4c1 |
Protein Id: | P62806 |
Protein Name: | H4_MOUSE |
PTM: | acetylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Respiratory system diseases |
Disease: | Acute Lung Injury |
Disease Subtype: | sepsis-induced acute lung injury |
Disease Cellline: | J774A.1 |
Disease Info: | |
Drug: | Colchicine |
Drug Info: | Colchicine is an alkaloid drug. It is commonly used in the treatment of gout and familial Mediterranean fever. |
Relation: |
Colchicine
➜
Histone H4-unclear
DOWN
➜
Acute Lung Injury
Alleviate
|
Effect: | modulate |
Effect Info: | "Colchicine inhibits the phosphorylation of STAT3 and prevents its binding to the histone acetyltransferase EP300, thereby indirectly suppressing the acetylation levels of H3/H4 at the NLRP3 promoter, reducing the activity of the NLRP3 inflammasome and pyroptosis." |
Note: | histone |
Score: | 3.0 |
Pubmed(PMID): | 37115345 |
Sentence Index: | 37115345_0 |
Sentence: | Inhibition of STAT3 phosphorylation by colchicine regulates NLRP3 activation to alleviate sepsis-induced acute lung injury. |
Sequence & Structure:
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.