Id: acc4758
Group: 1sens
Protein: Histone H3
Gene Symbol: H3c1
Protein Id: P68433
Protein Name: H31_MOUSE
PTM: acetylation
Site: unclear
Site Sequence:
Disease Category: Respiratory system diseases
Disease: Acute Lung Injury
Disease Subtype: sepsis-induced acute lung injury
Disease Cellline: J774A.1
Disease Info:
Drug: Colchicine
Drug Info: Colchicine is an alkaloid drug. It is commonly used in the treatment of gout and familial Mediterranean fever.
Relation:
Colchicine
Histone H3-unclear DOWN
Acute Lung Injury Alleviate
Effect: modulate
Effect Info: "Colchicine inhibits the phosphorylation of STAT3 and prevents its binding to the histone acetyltransferase EP300, thereby indirectly suppressing the acetylation levels of H3/H4 at the NLRP3 promoter, reducing the activity of the NLRP3 inflammasome and pyroptosis."
Note: histone
Score: 3.0
Pubmed(PMID): 37115345
Sentence Index:
Sentence:

Sequence & Structure:

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: