Id: acc4743
Group: 1sens
Protein: p38 MAPK
Gene Symbol: Mapk14
Protein Id: P70618
Protein Name: MK14_RAT
PTM: phosphorylation
Site: Tyr182
Site Sequence: RHTDDEMTGYVATRWYRAPEI
Disease Category: Nervous system diseases
Disease: Spinal Cord Injury
Disease Subtype: primary traumatic spinal cord injury
Disease Cellline:
Disease Info:
Drug: AG1478
Drug Info: "AG1478 is a potent and selective inhibitor of the epidermal growth factor receptor (EGFR) tyrosine kinase, which has been widely used in cancer research to study the role of EGFR signaling pathways."
Relation:
AG1478
p38 MAPK-Tyr182 DOWN
Spinal Cord Injury Alleviate
Effect: modulate
Effect Info: "Inhibition of EGFR phosphorylation using C225 or AG1478, and significant EGFR blockade reduced MAPK activation, decreased nerve inflammation-related damage, and promoted axonal growth and functional recovery."
Note:
Score: 4.0
Pubmed(PMID): 22824323
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: