Id: | acc4721 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63086 |
Protein Name: | MK01_RAT |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HTGFLTEYVATRWYRAPEIML |
Disease Category: | Nervous system diseases |
Disease: | Status Epilepticus |
Disease Subtype: | neuronal death |
Disease Cellline: | |
Disease Info: | |
Drug: | Leptomycin B + Cyclosporin A |
Drug Info: | "Leptomycin B (LMB) is a natural product and a potent inhibitor of exportin 1 (CRM1), which plays a crucial role in nuclear export of proteins. | Cyclosporin A (CsA) is a cyclic undecapeptide and a well - known immunosuppressive agent that acts by inhibiting calcineurin, thereby interfering with T - cell activation. " |
Relation: |
Leptomycin B + Cyclosporin A
➜
ERK2-Tyr187
UP
➜
Status Epilepticus
Alleviate
|
Effect: | modulate |
Effect Info: | "LMB can upregulate the phosphorylation of PKA and PP2B, activate PKA, inhibit PP2B, and then upregulate ERK1/2, thereby exerting a neuroprotective effect. Combining with CsA can further enhance the phosphorylation of ERK and strengthen the effect of LMB." |
Note: | drug comb |
Score: | 4.0 |
Pubmed(PMID): | 28601633 |
Sentence Index: | 28601633_8 |
Sentence: | U0126 (an ERK1/2 inhibitor) co-treatment abolished the protective effect of LMB on SE-induced neuronal death without alterations in PKA and PP2B phosphorylations. |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | A | Basophilic leukemia | Phosphorylation | 11971018 |
T | 183 | D | Major depressive disorder | Phosphorylation | 16959794 |
Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
T | 183 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.