Id: | acc4712 |
Group: | 1sens |
Protein: | PKA |
Gene Symbol: | Prkaca |
Protein Id: | P27791 |
Protein Name: | KAPCA_RAT |
PTM: | phosphorylation |
Site: | Thr197 |
Site Sequence: | FAKRVKGRTWTLCGTPEYLAP |
Disease Category: | Nervous system diseases |
Disease: | Status Epilepticus |
Disease Subtype: | neuronal death |
Disease Cellline: | |
Disease Info: | |
Drug: | Leptomycin B |
Drug Info: | "Leptomycin B (LMB) is a potent and specific inhibitor of nuclear export. It functions by covalently binding to the nuclear export receptor CRM1, thereby blocking the export of various proteins from the nucleus. " |
Relation: |
Leptomycin B
➜
PKA-Thr197
UP
➜
Status Epilepticus
Alleviate
|
Effect: | modulate |
Effect Info: | "LMB can upregulate the phosphorylation of PKA and PP2B, activate PKA, inhibit PP2B, and then upregulate ERK1/2, thereby exerting a neuroprotective effect. Combining with CsA can further enhance the phosphorylation of ERK and strengthen the effect of LMB." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 28601633 |
Sentence Index: | 28601633_8 |
Sentence: | U0126 (an ERK1/2 inhibitor) co-treatment abolished the protective effect of LMB on SE-induced neuronal death without alterations in PKA and PP2B phosphorylations. |
Sequence & Structure:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWEDPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.