Id: | acc4702 |
Group: | 2sens |
Protein: | histone H3 |
Gene Symbol: | H3C1 |
Protein Id: | P68431 |
Protein Name: | H31_HUMAN |
PTM: | acetylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Lung Cancer |
Disease Subtype: | small cell lung carcinomas (SCLCs) |
Disease Cellline: | U1906 |
Disease Info: | |
Drug: | TRAIL |
Drug Info: | Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) is a promising drug for the treatment of tumors |
Relation: |
TRAIL
➜
histone H3-unclear
UP
➜
Lung Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | "The synergistic effect of VPA and decitabine promotes strong and persistent histone acetylation, inhibits DNMT, restores the expression of caspase-8, and ultimately enhances the sensitivity of SCLC cells to TRAIL." |
Note: | "drug comb,histone" |
Score: | 3.0 |
Pubmed(PMID): | 21771726 |
Sentence Index: | 21771726_4-5 |
Sentence: | "We found that combination of the DNMT inhibitor decitabine with an inhibitor of histone deacetylase (HDAC) significantly increased caspase-8 expression in SCLC cells at the RNA and protein levels. Among all studied HDAC inhibitors, valproic acid (VPA) and CI-994 showed prolonged effects on histone acetylation, while combination with decitabine produced the most prominent effects on caspase-8 re-expression." |
Sequence & Structure:
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 27 | A | Oligodendroglioma | Methylation | 34020723 |
K | 4 | D | Breast cancer | Methylation | 19943104 |
K | 27 | D | Cervical intraepithelial neoplasia | Acetylation | 28716899 |
K | 27 | D | Ovarian cancer | Methylation | 20053926 |
K | 27 | D | Malignant peripheral nerve sheath tumor | Methylation | 28752843 |
K | 27 | D | Autism spectrum disorder | Methylation | 23423141 |
K | 4 | D | Lung cancer | Methylation | 26301496 |
K | 4 | D | Liver cancer | Methylation | 26301496 |
K | 4 | D | Breast cancer | Methylation | 26301496 |
K | 27 | D | Acute myelogenous leukemia | Methylation | 22897849 |
K | 4 | D | Fragile X syndrome | Methylation | 18628788 |
K | 4 | D | Oral squamous cell carcinoma | Methylation | 19753335 |
K | 4 | D | Prostate cancer | Methylation | 19739128 |
K | 18 | D | Pancreatic carcinoma | Methylation | 20142597 |
K | 18 | D | Hepatocellular carcinoma | Acetylation | 25613642 |
K | 9 | D | Prostate cancer | Methylation | 19739128 |
K | 9 | D | Pancreatic carcinoma | Methylation | 20142597 |
K | 4 | D | Pancreatic carcinoma | Methylation | 20142597 |
K | 27 | D | Systemic lupus erythematosus | Methylation | 36165173 |
K | 9 | D | Diabetes mellitus | Acetylation | 23423566 |
K | 9 | D | Friedreich's ataxia | Acetylation | 18045775 |
K | 9 | D | Prostate cancer | Acetylation | 19885564 |
K | 9 | D | Systemic lupus erythematosus | Acetylation | 36165173 |
S | 10 | D | Breast cancer | Phosphorylation | 21146603 |
K | 14 | D | Cervical intraepithelial neoplasia | Acetylation | 28716899 |
K | 14 | D | Prostate cancer | Acetylation | 19885564 |
K | 18 | D | Prostate cancer | Acetylation | 19885564 |
K | 14 | D | Systemic lupus erythematosus | Acetylation | 36165173 |
K | 23 | D | Prostate cancer | Acetylation | 19885564 |
K | 27 | U | Follicular lymphoma | Methylation | 35661922 |
T | 11 | U | Prostate cancer | Phosphorylation | 18066052 |
K | 4 | U | Bile duct cancer | Methylation | 19896696 |
K | 4 | U | Gastric cancer | Methylation | 19896696 |
K | 4 | U | Neuroendocrine cancer | Methylation | 19896696 |
K | 4 | U | Pancreatic ductal adenocarcinoma | Methylation | 19896696 |
T | 6 | U | Prostate cancer | Phosphorylation | 20228790 |
K | 9 | U | Friedreich's ataxia | Methylation | 18045775 |
K | 4 | U | Oral squamous cell carcinoma | Methylation | 19753335 |
S | 10 | U | Breast adenocarcinoma | Phosphorylation | 16461563 |
K | 27 | U | Pediatric-type follicular lymphoma | Methylation | 35661922 |
K | 27 | U | Primary cutaneous follicle center cell lymphoma | Methylation | 35661922 |
K | 79 | U | Leukemia | Methylation | 23361907 |
K | 9 | U | Friedreich's ataxia | Methylation | 18045775 |
K | 4 | U | Autism spectrum disorder | Methylation | 23423141 |
K | 56 | U | Colorectal cancer | Acetylation | 19270680 |
K | 9 | U | Prostate cancer | Acetylation | 19935671 |
K | 4 | U | Marfan syndrome | Acetylation | 20829218 |
K | 9 | U | Diabetes mellitus | Acetylation | 23423566 |
K | 9 | U | Gastric adenocarcinoma | Acetylation | 18470569 |
K | 9 | U | Type 2 diabetes | Acetylation | 34944721 |
K | 14 | U | Marfan syndrome | Acetylation | 20829218 |
K | 18 | U | Colorectal cancer | Acetylation | 19057998 |
K | 18 | U | Esophageal carcinoma | Acetylation | 20142251 |
K | 27 | U | Anaplastic large cell lymphoma | Acetylation | 22899583 |
K | 27 | U | Melanoma | Acetylation | 32079144 |
K | 27 | U | Merkel cell carcinoma | Acetylation | 25941994 |
K | 56 | U | Astrocytoma | Acetylation | 19270680 |
K | 4 | U | Prostate cancer | Methylation | 19935671 |
K | 56 | U | Glioma | Acetylation | 19270680 |
K | 56 | U | Laryngeal cancer | Acetylation | 19270680 |
K | 56 | U | Oligodendroglioma | Acetylation | 19270680 |
K | 56 | U | Testicular cancer | Acetylation | 19270680 |
K | 56 | U | Thyroid cancer | Acetylation | 19270680 |
K | 36 | U | Acute myelogenous leukemia | Methylation | 17589499 |
K | 4 | U | Marfan syndrome | Methylation | 20829218 |
K | 9 | U | Breast cancer | Methylation | 19943104 |
K | 27 | U | Fragile X syndrome | Methylation | 18628788 |
K | 36 | U | Clear cell kidney cancer | Methylation | 28754676 |
K | 79 | U | Acute lymphocytic leukemia | Methylation | 18977325 |
K | 79 | U | Lung cancer | Methylation | 22190683 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.