Id: acc4696
Group: 1sens
Protein: ERK2
Gene Symbol: Mapk1
Protein Id: P63086
Protein Name: MK01_RAT
PTM: phosphorylation
Site: Tyr187
Site Sequence: HTGFLTEYVATRWYRAPEIML
Disease Category: Nervous system diseases
Disease: Spinal Cord Injury
Disease Subtype: bladder overactivity
Disease Cellline:
Disease Info:
Drug: PD98059
Drug Info: "PD98059 is a selective and cell - permeable inhibitor of MEK1, which blocks the activation of MAPK and is widely used in research on the MAPK signaling pathway."
Relation:
PD98059
ERK2-Tyr187 DOWN
Spinal Cord Injury Alleviate
Effect: modulate
Effect Info: "The phosphorylation level of ERK is upregulated in the spinal cord of chronic SCI rats. Injecting PD98059, a specific inhibitor of ERK phosphorylation, can reduce the frequency and amplitude of bladder contractions in animals with spinal cord injury, but has no effect on animals with intact spinal cords."
Note:
Score: 4.0
Pubmed(PMID): 16513110
Sentence Index:
Sentence:

Sequence & Structure:

MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
- - A Basophilic leukemia Phosphorylation 11971018
T 183 D Major depressive disorder Phosphorylation 16959794
Y 185 D Major depressive disorder Phosphorylation 16959794
T 183 U Uteroplacental insufficiency Phosphorylation 16940436
Y 185 U Uteroplacental insufficiency Phosphorylation 16940436

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: