Id: | acc4695 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63086 |
Protein Name: | MK01_RAT |
PTM: | phosphorylation |
Site: | Thr185 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Nervous system diseases |
Disease: | Spinal Cord Injury |
Disease Subtype: | bladder overactivity |
Disease Cellline: | |
Disease Info: | |
Drug: | PD98059 |
Drug Info: | "PD98059 is a selective and cell - permeable inhibitor of MEK1, which blocks the activation of MAPK and is widely used in research on the MAPK signaling pathway." |
Relation: |
PD98059
➜
ERK2-Thr185
DOWN
➜
Spinal Cord Injury
Alleviate
|
Effect: | modulate |
Effect Info: | "The phosphorylation level of ERK is upregulated in the spinal cord of chronic SCI rats. Injecting PD98059, a specific inhibitor of ERK phosphorylation, can reduce the frequency and amplitude of bladder contractions in animals with spinal cord injury, but has no effect on animals with intact spinal cords." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 16513110 |
Sentence Index: | 16513110_10 |
Sentence: | "Intrathecal administration of PD98059, a specific inhibitor of ERK phosphorylation, reduced the frequency and amplitude of bladder contractions in SCI animals but not in spinal intact ones." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.