Id: | acc4677 |
Group: | 1sens |
Protein: | c-Fos |
Gene Symbol: | FOS |
Protein Id: | P01100 |
Protein Name: | FOS_HUMAN |
PTM: | phosphorylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Immune system diseases |
Disease: | Rheumatoid Arthritis |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Bradykinin |
Drug Info: | "Bradykinin (BK) is a nonapeptide involved in various physiological processes, including vasodilation, inflammation, and pain perception. It acts by binding to specific receptors and plays a crucial role in the regulation of blood pressure and tissue homeostasis." |
Relation: |
Bradykinin
➜
c-Fos-unclear
UP
➜
Rheumatoid Arthritis
Aggravate
|
Effect: | modulate |
Effect Info: | "BK activates MAPKs (ERK1/2, p38 MAPK, JNK1/2) through PKCμ, leading to the phosphorylation of transcription factors AP-1 (c-Jun/c-Fos) and NF-kappaB, which in turn promotes the intensification of the inflammatory response and the progression of RA." |
Note: | inducer |
Score: | 4.0 |
Pubmed(PMID): | 28288820 |
Sentence Index: | 28288820_0 |
Sentence: | Resveratrol inhibits BK-induced COX-2 transcription by suppressing acetylation of AP-1 and NF-kappaB in human rheumatoid arthritis synovial fibroblasts. |
Sequence & Structure:
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
FOS-Ser122 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | 0.476 |
LUAD | 0.673 |
LUSC | -1.149 |
non_ccRCC | |
PDAC | |
UCEC |
FOS-Ser133 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | 0.707 |
LUAD | |
LUSC | -0.707 |
non_ccRCC | |
PDAC | |
UCEC |
FOS-Ser258 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | |
LUAD | -0.637 |
LUSC | -0.516 |
non_ccRCC | |
PDAC | 1.153 |
UCEC |
FOSB-Ser244 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | 0.477 |
GBM | |
HNSC | |
LUAD | 0.916 |
LUSC | -1.391 |
non_ccRCC | |
PDAC | |
UCEC | -0.002 |
FOSB-Thr151 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | 1.134 |
GBM | |
HNSC | |
LUAD | -0.754 |
LUSC | -0.38 |
non_ccRCC | |
PDAC | |
UCEC |
FOSL2-Ser120 | |
---|---|
Cancer | Intensity |
BRCA | 0.037 |
COAD | 0.522 |
HGSC | -2.803 |
ccRCC | 0.382 |
GBM | 0.529 |
HNSC | 0.203 |
LUAD | -0.163 |
LUSC | -0.505 |
non_ccRCC | 0.531 |
PDAC | 0.506 |
UCEC | 0.762 |
FOSL2-Ser16 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | 0.707 |
HGSC | -0.707 |
ccRCC | |
GBM | |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
FOSL2-Ser19 | |
---|---|
Cancer | Intensity |
BRCA | 1.429 |
COAD | -0.137 |
HGSC | -0.197 |
ccRCC | |
GBM | -0.141 |
HNSC | -0.169 |
LUAD | 0.57 |
LUSC | 0.357 |
non_ccRCC | 0.06 |
PDAC | -2.439 |
UCEC | 0.667 |
FOSL2-Ser194 | |
---|---|
Cancer | Intensity |
BRCA | 1.228 |
COAD | |
HGSC | |
ccRCC | |
GBM | -0.162 |
HNSC | -0.187 |
LUAD | 0.468 |
LUSC | 0.279 |
non_ccRCC | 0.016 |
PDAC | -2.197 |
UCEC | 0.554 |
FOSL2-Ser200 | |
---|---|
Cancer | Intensity |
BRCA | 0.173 |
COAD | 0.178 |
HGSC | -0.26 |
ccRCC | 0.635 |
GBM | 1.093 |
HNSC | -0.433 |
LUAD | -0.983 |
LUSC | -1.252 |
non_ccRCC | 1.596 |
PDAC | -1.541 |
UCEC | 0.794 |
FOSL2-Ser211 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | -0.492 |
GBM | |
HNSC | 1.071 |
LUAD | 1.074 |
LUSC | -0.611 |
non_ccRCC | |
PDAC | |
UCEC | -1.041 |
FOSL2-Ser215 | |
---|---|
Cancer | Intensity |
BRCA | 1.225 |
COAD | |
HGSC | |
ccRCC | -1.019 |
GBM | |
HNSC | -0.071 |
LUAD | -1.573 |
LUSC | 0.915 |
non_ccRCC | |
PDAC | 0.201 |
UCEC | 0.322 |
FOSL2-Ser230 | |
---|---|
Cancer | Intensity |
BRCA | 2.331 |
COAD | 0.21 |
HGSC | 0.957 |
ccRCC | -0.087 |
GBM | 0.304 |
HNSC | -0.661 |
LUAD | -1.208 |
LUSC | -0.311 |
non_ccRCC | 0.001 |
PDAC | -1.178 |
UCEC | -0.358 |
FOSL2-Ser232 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | -0.136 |
ccRCC | 0.577 |
GBM | |
HNSC | 0.609 |
LUAD | 0.642 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | -1.693 |
FOSL2-Ser235 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | |
LUAD | |
LUSC | 1.058 |
non_ccRCC | |
PDAC | -0.129 |
UCEC | -0.929 |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.