Id: | acc4631 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | Smad3 |
Protein Id: | Q8BUN5 |
Protein Name: | SMAD3_MOUSE |
PTM: | phosphorylation |
Site: | Ser425 |
Site Sequence: | SPSIRCSSVS----------- |
Disease Category: | Urinary and reproductive system diseases |
Disease: | Renal Fibrosis |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | BT173 |
Drug Info: | No information is available to provide a formal and academic description of BT173. |
Relation: |
BT173
➜
Smad3-Ser425
DOWN
➜
Renal Fibrosis
Alleviate
|
Effect: | modulate |
Effect Info: | BT173 can reduce Smad3 phosphorylation and alleviate renal fibrosis and extracellular matrix deposition in unilateral ureteral obstruction and Tg26 mouse models of renal fibrosis. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 28220029 |
Sentence Index: | 28220029_7 |
Sentence: | "In vivo, administration of BT173 decreased Smad3 phosphorylation and mitigated renal fibrosis and deposition of extracellular matrix in unilateral ureteral obstruction and Tg26 mouse models of renal fibrosis." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 204 | D | Obesity | Phosphorylation | 29700281 |
- | - | D | Chronic kidney disease | Phosphorylation | 23264657 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.