Id: | acc4627 |
Group: | 1sens |
Protein: | p38 MAPK |
Gene Symbol: | Mapk14 |
Protein Id: | P47811 |
Protein Name: | MK14_MOUSE |
PTM: | phosphorylation |
Site: | Tyr182 |
Site Sequence: | RHTDDEMTGYVATRWYRAPEI |
Disease Category: | Urinary and reproductive system diseases |
Disease: | Renal Fibrosis |
Disease Subtype: | diabetic nephropathy |
Disease Cellline: | |
Disease Info: | |
Drug: | Telmisartan |
Drug Info: | "Telmisartan is an angiotensin II receptor blocker (ARB) used for the treatment of hypertension. It works by blocking the action of angiotensin II, thereby relaxing blood vessels and reducing blood pressure." |
Relation: |
Telmisartan
➜
p38 MAPK-Tyr182
DOWN
➜
Renal Fibrosis
Alleviate
|
Effect: | modulate |
Effect Info: | "Telmisartan inhibits the upstream signal of Ang-II (AT1R) and activates PPAR-gamma expression, reversing the increased phosphorylation levels of p38 MAPK, MAPKAPK-2, and Akt in diabetic nephropathy (DN) mice and improving oxidative stress and renal fibrosis." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 21381899 |
Sentence Index: | 21381899_0 |
Sentence: | Telmisartan attenuates oxidative stress and renal fibrosis in streptozotocin induced diabetic mice with the alteration of angiotensin-(1-7) mas receptor expression associated with its PPAR-gamma agonist action. |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.