Id: acc4627
Group: 1sens
Protein: p38 MAPK
Gene Symbol: Mapk14
Protein Id: P47811
Protein Name: MK14_MOUSE
PTM: phosphorylation
Site: Tyr182
Site Sequence: RHTDDEMTGYVATRWYRAPEI
Disease Category: Urinary and reproductive system diseases
Disease: Renal Fibrosis
Disease Subtype: diabetic nephropathy
Disease Cellline:
Disease Info:
Drug: Telmisartan
Drug Info: "Telmisartan is an angiotensin II receptor blocker (ARB) used for the treatment of hypertension. It works by blocking the action of angiotensin II, thereby relaxing blood vessels and reducing blood pressure."
Relation:
Telmisartan
p38 MAPK-Tyr182 DOWN
Renal Fibrosis Alleviate
Effect: modulate
Effect Info: "Telmisartan inhibits the upstream signal of Ang-II (AT1R) and activates PPAR-gamma expression, reversing the increased phosphorylation levels of p38 MAPK, MAPKAPK-2, and Akt in diabetic nephropathy (DN) mice and improving oxidative stress and renal fibrosis."
Note:
Score: 4.0
Pubmed(PMID): 21381899
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: