Id: | acc4622 |
Group: | 1sens |
Protein: | YAP |
Gene Symbol: | YAP1 |
Protein Id: | P46937 |
Protein Name: | YAP1_HUMAN |
PTM: | phosphorylation |
Site: | Ser127 |
Site Sequence: | LTPQHVRAHSSPASLQLGAVS |
Disease Category: | Urinary and reproductive system diseases |
Disease: | Renal Fibrosis |
Disease Subtype: | |
Disease Cellline: | HK-2 |
Disease Info: | |
Drug: | GW4064 |
Drug Info: | GW4064 is a selective agonist of the farnesoid X receptor (FXR). It has potential applications in research related to bile acid metabolism and liver diseases. |
Relation: |
GW4064
➜
YAP-Ser127
UP
➜
Renal Fibrosis
Alleviate
|
Effect: | modulate |
Effect Info: | "GW4064 activates FXR, enhances the phosphorylation of YAP at Ser127, promotes its cytoplasmic retention, and inhibits fibrosis." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 31298930 |
Sentence Index: | 31298930_4 |
Sentence: | "Here, we show that agonist GW4064-mediated FXR activation inhibits the activity of the nonreceptor tyrosine kinase Src (proto-oncogene tyrosine-protein kinase), which is critical for regulation of yes-associated protein (YAP) phosphorylation and nuclear localization in renal fibrosis." |
Sequence & Structure:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACYAP1-Ser127 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | 0.729 |
HGSC | -1.387 |
ccRCC | |
GBM | |
HNSC | 0.735 |
LUAD | -0.077 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 127 | A | Hepatocellular carcinoma/hepatocarcinoma/hepatoma | Phosphorylation | 22761457 |
S | 127 | A | Adult T-cell leukemia/lymphoma | Phosphorylation | 35210364 |
S | 127 | D | Bladder cancer | Phosphorylation | 26119935 |
S | 127 | D | Glioblastoma | Phosphorylation | 34343153 |
S | 127 | D | Prostate cancer | Phosphorylation | 36823643 |
S | 127 | D | Lung cancer/carcinoma | Phosphorylation | 21060948 |
S | 127 | D | Renal cell carcinoma | Phosphorylation | 32926756 |
S | 127 | D | Liver cancer | Phosphorylation | 28474680 |
S | 127 | D | Diabetes mellitus | Phosphorylation | 28474680 |
S | 127 | D | Coronary artery disease | Phosphorylation | 37104914 |
S | 127 | P | Cervical cancer/carcinoma | Phosphorylation | 23027127 |
S | 127 | P | Hepatocellular cancer | Phosphorylation | 35597479 |
S | 127 | P | Colon cancer | Phosphorylation | 34206989 |
S | 127 | U | Hepatocellular cancer | Phosphorylation | 35586495 |
S | 127 | U | Parkinson's disease | Phosphorylation | 32929029 |
S | 127 | U | Osteoarthritis | Phosphorylation | 37100374 |
S | 127 | U | Breast cancer | Phosphorylation | 36774339 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.