Id: | acc4582 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63085 |
Protein Name: | MK01_MOUSE |
PTM: | phosphorylation |
Site: | Thr185 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Respiratory system diseases |
Disease: | Chronic Obstructive Pulmonary Disease |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Mahuang-Tang water extract |
Drug Info: | "Mahuang-Tang water extract (MTWE) is an aqueous extract of Mahuang-Tang, a traditional Chinese medicine formula. It is potentially used in the treatment of various diseases due to its multiple bioactive compounds. " |
Relation: |
Mahuang-Tang water extract
➜
ERK2-Thr185
DOWN
➜
Chronic Obstructive Pulmonary Disease
Alleviate
|
Effect: | modulate |
Effect Info: | "The aqueous extract of Mahuang-Tang significantly reduces the pulmonary inflammatory response and MMP-9 expression induced by cigarette smoke and LPS by inhibiting ERK phosphorylation (a key step in MAPK pathway activation), thereby effectively alleviating airway inflammation associated with COPD in both in vitro and in vivo models." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 31004880 |
Sentence Index: | 31004880_13 |
Sentence: | "CONCLUSION: Overall, MTWE effectively inhibited the pulmonary inflammation and MMP-9 expression caused by the CS and LPS exposure, which was closely involved in suppression of Erk phosphorylation." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | D | EL4 thymoma | Phosphorylation | 10753946 |
T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.