Id: acc4582
Group: 1sens
Protein: ERK2
Gene Symbol: Mapk1
Protein Id: P63085
Protein Name: MK01_MOUSE
PTM: phosphorylation
Site: Thr185
Site Sequence: HDHTGFLTEYVATRWYRAPEI
Disease Category: Respiratory system diseases
Disease: Chronic Obstructive Pulmonary Disease
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: Mahuang-Tang water extract
Drug Info: "Mahuang-Tang water extract (MTWE) is an aqueous extract of Mahuang-Tang, a traditional Chinese medicine formula. It is potentially used in the treatment of various diseases due to its multiple bioactive compounds. "
Relation:
Mahuang-Tang water extract
ERK2-Thr185 DOWN
Chronic Obstructive Pulmonary Disease Alleviate
Effect: modulate
Effect Info: "The aqueous extract of Mahuang-Tang significantly reduces the pulmonary inflammatory response and MMP-9 expression induced by cigarette smoke and LPS by inhibiting ERK phosphorylation (a key step in MAPK pathway activation), thereby effectively alleviating airway inflammation associated with COPD in both in vitro and in vivo models."
Note:
Score: 4.0
Pubmed(PMID): 31004880
Sentence Index:
Sentence:

Sequence & Structure:

MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
- - D EL4 thymoma Phosphorylation 10753946
T 183 U Mammary tumor/carcinoma Phosphorylation 12754301
T 188 U Heart failure Phosphorylation 19060905

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: