Id: acc4572
Group: 1sens
Protein: SMAD3
Gene Symbol: Smad3
Protein Id: Q8BUN5
Protein Name: SMAD3_MOUSE
PTM: phosphorylation
Site: Ser425
Site Sequence: SPSIRCSSVS-----------
Disease Category: Cardiovascular and circulatory system diseases
Disease: Pulmonary Hypertension
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: Fasudil
Drug Info: Fasudil is a rho - kinase inhibitor. It is used to improve cerebrovascular spasm after subarachnoid hemorrhage and has potential applications in the treatment of other vascular - related diseases.
Relation:
Fasudil
SMAD3-Ser425 DOWN
Pulmonary Hypertension Alleviate
Effect: modulate
Effect Info: "Fasudil indirectly inhibits TGF-beta1-mediated Smad2/3 phosphorylation by suppressing the activity of the RhoA/ROCK pathway, thereby alleviating manifestations of pulmonary fibrosis (PF) and pulmonary hypertension (PH), including elevated right ventricular systolic pressure and pulmonary vascular remodeling."
Note:
Score: 4.0
Pubmed(PMID): 23928001
Sentence Index:
Sentence:

Sequence & Structure:

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 204 D Obesity Phosphorylation 29700281
- - D Chronic kidney disease Phosphorylation 23264657

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: