Id: acc4538
Group: 1sens
Protein: GSK3beta
Gene Symbol: Gsk3b
Protein Id: P18266
Protein Name: GSK3B_RAT
PTM: phosphorylation
Site: Ser9
Site Sequence: -MSGRPRTTSFAESCKPVQQP
Disease Category: Nervous system diseases
Disease: Psychiatric Disorders
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: Lithium
Drug Info: Lithium is a chemical element and a mood - stabilizing medication. It is commonly used in the treatment of bipolar disorder to help control mood swings.
Relation:
Lithium
GSK3beta-Ser9 UP
Psychiatric Disorders Alleviate
Effect: modulate
Effect Info: "Lithium increases the phosphorylation of GSK3beta at the Ser9 site, inhibits its activity, thereby reducing the degradation of beta-catenin and promoting the expression of the GluN2A subunit, which helps to improve cognitive impairment."
Note:
Score: 4.0
Pubmed(PMID): 29449801
Sentence Index:
Sentence:

Sequence & Structure:

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: