Id: | acc4538 |
Group: | 1sens |
Protein: | GSK3beta |
Gene Symbol: | Gsk3b |
Protein Id: | P18266 |
Protein Name: | GSK3B_RAT |
PTM: | phosphorylation |
Site: | Ser9 |
Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
Disease Category: | Nervous system diseases |
Disease: | Psychiatric Disorders |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Lithium |
Drug Info: | Lithium is a chemical element and a mood - stabilizing medication. It is commonly used in the treatment of bipolar disorder to help control mood swings. |
Relation: |
Lithium
➜
GSK3beta-Ser9
UP
➜
Psychiatric Disorders
Alleviate
|
Effect: | modulate |
Effect Info: | "Lithium increases the phosphorylation of GSK3beta at the Ser9 site, inhibits its activity, thereby reducing the degradation of beta-catenin and promoting the expression of the GluN2A subunit, which helps to improve cognitive impairment." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 29449801 |
Sentence Index: | 29449801_3 |
Sentence: | "Lithium, a clinically relevant drug commonly prescribed as a mood stabilizer for psychiatric disorders, significantly increased levels of phosphorylated GSK3beta serine 9, an inhibitory phosphorylation site, and decreased beta-catenin ser33/37/thr41 phosphorylation in vitro, indicating GSK3beta inhibition and reduced beta-catenin degradation." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.