Id: acc4532
Group: 1sens
Protein: GSK3beta
Gene Symbol: Gsk3b
Protein Id: Q9WV60
Protein Name: GSK3B_MOUSE
PTM: phosphorylation
Site: Ser9
Site Sequence: -MSGRPRTTSFAESCKPVQQP
Disease Category: Infectious diseases
Disease: Melioidosis
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: Chloroquine+ doxycycline
Drug Info: "Chloroquine is a medication used to prevent and treat malaria in certain regions where malaria remains sensitive. It also has immunomodulatory effects and has been investigated for other uses such as in the treatment of autoimmune diseases. | Doxycycline is a broad - spectrum antibiotic of the tetracycline class. It is commonly used to treat a wide variety of bacterial infections, including respiratory tract infections, acne, and tick - borne diseases. "
Relation:
Chloroquine+ doxycycline
GSK3beta-Ser9 UP
Melioidosis Alleviate
Effect: modulate
Effect Info: "Chloroquine treatment induces the phosphorylation of GSK3beta at the Ser9 site through the Akt pathway, thereby inhibiting its activity. When used in combination with doxycycline, this adjuvant therapy can suppress pro-inflammatory cytokines and improve the survival rate of patients with melioidosis."
Note: drug comb
Score: 4.0
Pubmed(PMID): 33612800
Sentence Index:
Sentence:

Sequence & Structure:

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: