Id: | acc4476 |
Group: | 1sens |
Protein: | alpha-synuclein |
Gene Symbol: | SNCA |
Protein Id: | P37840 |
Protein Name: | SYUA_HUMAN |
PTM: | phosphorylation |
Site: | Ser129 |
Site Sequence: | PDNEAYEMPSEEGYQDYEPEA |
Disease Category: | Nervous system diseases |
Disease: | Parkinson's Disease |
Disease Subtype: | LRRK2 G2019S?mutation mDAN |
Disease Cellline: | |
Disease Info: | |
Drug: | PFE-360 |
Drug Info: | PFE - 360 is a drug. It may have specific medical functions and applications. |
Relation: |
PFE-360
➜
alpha-synuclein-Ser129
DOWN
➜
Parkinson's Disease
Alleviate
|
Effect: | modulate |
Effect Info: | "Treatment with PFE - 360 and MLi - 2 can reduce the phosphorylation and aggregation of aSyn by inhibiting LRRK2 kinase activity, potentially alleviating the progression of PD." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 36179692 |
Sentence Index: | 36179692_3 |
Sentence: | "Using automated fluorescence microscopy in 384-well-plate format, we identified elevated levels of alpha-synuclein (alphaSyn) and serine 129 phosphorylation, reduced dendritic complexity, and mitochondrial dysfunction." |
Sequence & Structure:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
SNCA | CINPANEMAB | Alpha-synuclein inhibitor | 2 | Terminated | Parkinson disease | ClinicalTrials |
SNCA | PRASINEZUMAB | Alpha-synuclein binding agent | 2 | Active, not recruiting | Parkinson disease | ClinicalTrials ClinicalTrials |
SNCA | CINPANEMAB | Alpha-synuclein inhibitor | 1 | Completed | Parkinson disease | ClinicalTrials |
SNCA | CINPANEMAB | Alpha-synuclein inhibitor | 1 | Terminated | Parkinson disease | ClinicalTrials |
SNCA | PRASINEZUMAB | Alpha-synuclein binding agent | 1 | Completed | Parkinson disease | ClinicalTrials ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
SNCA-Tyr39 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | -0.707 |
HNSC | |
LUAD | 0.707 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
SNCAIP-Ser269 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | 0.707 |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | -0.707 |
SNCAIP-Ser286 | |
---|---|
Cancer | Intensity |
BRCA | 1.033 |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | -0.069 |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | -0.964 |
SNCAIP-Ser607 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | -0.707 |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | 0.707 |
SNCAIP-Ser609 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | -0.707 |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | 0.707 |
SNCAIP-Ser610 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | -0.707 |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | 0.707 |
SNCAIP-Ser612 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | -0.707 |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | 0.707 |
SNCAIP-Ser613 | |
---|---|
Cancer | Intensity |
BRCA | -0.257 |
COAD | |
HGSC | |
ccRCC | |
GBM | 1.103 |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | -0.846 |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.