Id: | acc4475 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | Smad3 |
Protein Id: | P84025 |
Protein Name: | SMAD3_RAT |
PTM: | phosphorylation |
Site: | Ser425 |
Site Sequence: | SPSIRCSSVS----------- |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Cardiac Inflammation and Fibrosis |
Disease Subtype: | |
Disease Cellline: | T2DM rat |
Disease Info: | |
Drug: | Gentiopicroside |
Drug Info: | "Gentiopicroside is a bioactive compound found in certain plants, which has anti - inflammatory and other potential pharmacological effects." |
Relation: |
Gentiopicroside
➜
Smad3-Ser425
DOWN
➜
Cardiac Inflammation and Fibrosis
Alleviate
|
Effect: | modulate |
Effect Info: | "Gentiopicroside (50, 100 mg/kg GPS) alleviates cardiac inflammation and fibrosis in T2DM rats by targeting Smad3 phosphorylation." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 36037771 |
Sentence Index: | 36037771_0 |
Sentence: | Gentiopicroside alleviates cardiac inflammation and fibrosis in T2DM rats through targeting Smad3 phosphorylation. |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.