Id: acc4447
Group: 1sens
Protein: IL-33
Gene Symbol: Il33
Protein Id: Q8BVZ5
Protein Name: IL33_MOUSE
PTM: acetylation
Site: unclear
Site Sequence:
Disease Category: Immune system diseases
Disease: Asthma
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: MG149
Drug Info: MG149 is a drug that may have specific pharmacological effects and applications.
Relation:
MG149
IL-33-unclear DOWN
Asthma Alleviate
Effect: modulate
Effect Info: "MG149 inhibits the activity of KAT8, reduces the acetylation of IL-33, enhances the ubiquitination and degradation of IL-33, decreases the stability of IL-33, and thereby alleviates airway inflammation and hyperresponsiveness."
Note:
Score: 4.0
Pubmed(PMID): 34493712
Sentence Index:
Sentence:

Sequence & Structure:

MRPRMKYSNSKISPAKFSSTAGEALVPPCKIRRSQQKTKEFCHVYCMRLRSGLTIRKETSYFRKEPTKRYSLKSGTKHEENFSAYPRDSRKRSLLGSIQAFAASVDTLSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: