Id: | acc4446 |
Group: | 1sens |
Protein: | IL-33 |
Gene Symbol: | Il33 |
Protein Id: | Q8BVZ5 |
Protein Name: | IL33_MOUSE |
PTM: | ubiquitination |
Site: | unclear |
Site Sequence: | |
Disease Category: | Immune system diseases |
Disease: | Asthma |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | MG149 |
Drug Info: | MG149 is a drug that may have specific pharmacological effects and applications. |
Relation: |
MG149
➜
IL-33-unclear
UP
➜
Asthma
Alleviate
|
Effect: | modulate |
Effect Info: | "MG149 inhibits the activity of KAT8, reduces the acetylation of IL-33, enhances the ubiquitination and degradation of IL-33, decreases the stability of IL-33, and thereby alleviates airway inflammation and hyperresponsiveness." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 34493712 |
Sentence Index: | 34493712_0 |
Sentence: | MG149 inhibits histone acetyltransferase KAT8-mediated IL-33 acetylation to alleviate allergic airway inflammation and airway hyperresponsiveness. |
Sequence & Structure:
MRPRMKYSNSKISPAKFSSTAGEALVPPCKIRRSQQKTKEFCHVYCMRLRSGLTIRKETSYFRKEPTKRYSLKSGTKHEENFSAYPRDSRKRSLLGSIQAFAASVDTLSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.