Id: acc4444
Group: 1sens
Protein: P38
Gene Symbol: Mapk14
Protein Id: P47811
Protein Name: MK14_MOUSE
PTM: phosphorylation
Site: Thr180
Site Sequence: LARHTDDEMTGYVATRWYRAP
Disease Category: Respiratory system diseases
Disease: Acute Lung Injury
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: Chalcone derivatives 7w and(or) 7x
Drug Info: Chalcone derivatives 7w and 7x are chemical compounds belonging to the chalcone derivative class. They may have potential biological activities.
Relation:
Chalcone derivatives 7w and(or) 7x
P38-Thr180 DOWN
Acute Lung Injury Alleviate
Effect: modulate
Effect Info: "7w and 7x can reverse the increased phosphorylation of JNK, ERK, and P38 in LPS-induced lung injury."
Note:
Score: 4.0
Pubmed(PMID): 34480112
Sentence Index:
Sentence:

Sequence & Structure:

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: