Id: acc4416
Group: 1sens
Protein: Smad3
Gene Symbol: Smad3
Protein Id: Q8BUN5
Protein Name: SMAD3_MOUSE
PTM: phosphorylation
Site: Ser204
Site Sequence: QMNHSMDAGSPNLSPNPMSPA
Disease Category: Endocrine and metabolic diseases
Disease: Diabetes Mellitus
Disease Subtype: Diabetic kidney disease
Disease Cellline:
Disease Info:
Drug: Dapagliflozin
Drug Info: Dapagliflozin is a medication used in the management of type 2 diabetes. It works by inhibiting sodium - glucose cotransporter 2 (SGLT2) in the kidneys.
Relation:
Dapagliflozin
Smad3-Ser204 DOWN
Diabetes Mellitus Alleviate
Effect: modulate
Effect Info: Dapagliflozin inhibits hyperglycemia-induced Smad3 linker phosphorylation and CCN2 expression in a diabetic renal tubular epithelial cell model.
Note:
Score: 4.0
Pubmed(PMID): 34003249
Sentence Index:
Sentence:

Sequence & Structure:

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 204 D Obesity Phosphorylation 29700281

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: