Id: acc4394
Group: 1sens
Protein: Smad3
Gene Symbol: Smad3
Protein Id: P84025
Protein Name: SMAD3_RAT
PTM: phosphorylation
Site: Ser425
Site Sequence: SPSIRCSSVS-----------
Disease Category: Urinary and reproductive system diseases
Disease: Renal Fibrosis
Disease Subtype: Obstructive Nephropathy
Disease Cellline: NRK-47F
Disease Info:
Drug: Nintedanib + Gefitinib
Drug Info: Nintedanib is a small molecule tyrosine kinase inhibitor used in treating certain lung diseases. | Gefitinib is an epidermal growth factor receptor (EGFR) tyrosine kinase inhibitor for the treatment of non - small cell lung cancer.
Relation:
Nintedanib + Gefitinib
Smad3-Ser425 DOWN
Renal Fibrosis Alleviate
Effect: modulate
Effect Info: Nintedanib and Gefitinib synergistically inhibit the phosphorylation of Smad3 and block the TGF-beta1 signaling pathway.
Note:
Score: 4.0
Pubmed(PMID): 33614732
Sentence Index:
Sentence:

Sequence & Structure:

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: