Id: | acc4394 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | Smad3 |
Protein Id: | P84025 |
Protein Name: | SMAD3_RAT |
PTM: | phosphorylation |
Site: | Ser425 |
Site Sequence: | SPSIRCSSVS----------- |
Disease Category: | Urinary and reproductive system diseases |
Disease: | Renal Fibrosis |
Disease Subtype: | Obstructive Nephropathy |
Disease Cellline: | NRK-47F |
Disease Info: | |
Drug: | Nintedanib + Gefitinib |
Drug Info: | Nintedanib is a small molecule tyrosine kinase inhibitor used in treating certain lung diseases. | Gefitinib is an epidermal growth factor receptor (EGFR) tyrosine kinase inhibitor for the treatment of non - small cell lung cancer. |
Relation: |
Nintedanib + Gefitinib
➜
Smad3-Ser425
DOWN
➜
Renal Fibrosis
Alleviate
|
Effect: | modulate |
Effect Info: | Nintedanib and Gefitinib synergistically inhibit the phosphorylation of Smad3 and block the TGF-beta1 signaling pathway. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 33614732 |
Sentence Index: | 33614732_8 |
Sentence: | "Mechanistically, administration of nintedanib blocked UUO-induced phosphorylation of multiple kinase receptors associated renal fibrosis, including platelet-derived growth factor receptors, fibroblast growth factor receptors, vascular endothelial growth factor receptors, and Src family kinase, while gefitinib inhibited EGFR phosphorylation." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.