Id: | acc4385 |
Group: | 1sens |
Protein: | HMGB1 |
Gene Symbol: | Hmgb1 |
Protein Id: | P63159 |
Protein Name: | HMGB1_RAT |
PTM: | thiylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Respiratory system diseases |
Disease: | Hyperoxic Lung Injury |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | KYC |
Drug Info: | "KYC is a specific drug, but more detailed information about it is not provided here." |
Relation: |
KYC
➜
HMGB1-unclear
UP
➜
Hyperoxic Lung Injury
Alleviate
|
Effect: | modulate |
Effect Info: | KYC treatment → Total HMGB1↓ + Thiol modification↑ + Acetylation↑ → Binding to TLR4/RAGE↓ → Inflammatory signals weakened + Pulmonary cell death↓ |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 33607217 |
Sentence Index: | 33607217_7 |
Sentence: | "KYC treatment of hyperoxic pups decreased total HMGB1 in lung lysates, increased KYC thiylation of HMGB1, terminal HMGB1 thiol oxidation, decreased HMGB1 association with TLR4 and RAGE, and shifted HMGB1 in lung lysates from a non-acetylated to a lysyl-acetylated isoform, suggesting that KYC reduced lung cell death and that recruited immune cells had become the primary source of HMGB1 released into the hyperoxic lungs." |
Sequence & Structure:
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.