Id: acc4350
Group: 1sens
Protein: Rac1
Gene Symbol: Rac1
Protein Id: P63001
Protein Name: RAC1_MOUSE
PTM: nitration
Site: Tyr32
Site Sequence: YTTNAFPGEYIPTVFDNYSAN
Disease Category: Respiratory system diseases
Disease: Acute Lung Injury
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: NipR2 (nitration inhibitor peptide for the Rho GTPases 2)
Drug Info: NipR2 is a nitration inhibitor peptide for the Rho GTPases 2. It may play a role in inhibiting nitration related to Rho GTPases 2.
Relation:
NipR2 (nitration inhibitor peptide for the Rho GTPases 2)
Rac1-Tyr32 DOWN
Acute Lung Injury Alleviate
Effect: modulate
Effect Info: "NipR2 significantly inhibits the nitration modification of Rac1 at the Y32 site, restores its GTPase activity, thereby improving endothelial barrier function, reducing inflammation and pulmonary tissue damage, and improving lung function."
Note:
Score: 4.0
Pubmed(PMID): 33248422
Sentence Index:
Sentence:

Sequence & Structure:

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: