Id: acc4347
Group: 1sens
Protein: PP2A
Gene Symbol: PTPA
Protein Id: Q15257
Protein Name: PTPA_HUMAN
PTM: phosphorylation
Site: Tyr307
Site Sequence: MKTGPFAEHSNQLWNISAVPS
Disease Category: Cardiovascular and circulatory system diseases
Disease: Endothelial Dysfunction
Disease Subtype:
Disease Cellline: HUVECs
Disease Info:
Drug: Angiotensin II
Drug Info: Angiotensin II is a peptide hormone that plays a crucial role in regulating blood pressure and fluid balance. It constricts blood vessels and stimulates the release of aldosterone.
Relation:
Angiotensin II
➜
PP2A-Tyr307 DOWN
➜
Endothelial Dysfunction Aggravate
Effect: modulate
Effect Info: "AngII activates PP2A by downregulating the phosphorylation of the catalytic subunit Tyr307 of PP2A, thereby reducing eNOS phosphorylation levels and NO content, leading to endothelial dysfunction."
Note:
Score: 4.0
Pubmed(PMID): 33162896
Sentence Index:
Sentence:

Sequence & Structure:

MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: