Id: | acc4338 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | SMAD3 |
Protein Id: | P84022 |
Protein Name: | SMAD3_HUMAN |
PTM: | phosphorylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Respiratory system diseases |
Disease: | Pulmonary Fibrosis |
Disease Subtype: | Idiopathic Pulmonary Fibrosis |
Disease Cellline: | NHLF、DHLF、LL29 |
Disease Info: | |
Drug: | Biochanin-A(BCA) |
Drug Info: | Biochanin-A (BCA) is a natural isoflavone with potential health - promoting properties. It may have beneficial effects on various physiological functions. |
Relation: |
Biochanin-A(BCA)
➜
Smad3-unclear
DOWN
➜
Pulmonary Fibrosis
Alleviate
|
Effect: | inhibit |
Effect Info: | BCA treatment can significantly inhibit the phosphorylation levels of TGF-beta and its downstream Smad2/3 proteins in lung tissues and alleviate the pathological abnormalities of lung tissues induced by BLM. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 32781391 |
Sentence Index: | 32781391_13 |
Sentence: | "In addition, BCA treatment significantly (p < 0.001) attenuated the TGF-beta1/BLM-mediated increase of TGF-beta/Smad2/3 phosphorylation and resulted in the reduction of pathological abnormalities in lung tissues determined by histopathology observations." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 333 | D | Nonalcoholic steatohepatitis | Acetylation | 32305562 |
K | 341 | D | Renal fibrosis | Acetylation | 37777567 |
K | 378 | D | Nonalcoholic steatohepatitis | Acetylation | 32305562 |
K | 378 | D | Renal fibrosis | Acetylation | 37777567 |
K | 20 | U | Triple-negative breast cancer | Acetylation | 34392614 |
K | 117 | U | Triple-negative breast cancer | Acetylation | 34392614 |
K | 333 | U | Melanoma | Acetylation | 29520103 |
K | 53 | U | Cancer | Methylation | 35085106 |
K | 333 | U | Cancer | Methylation | 35085106 |
T | 179 | U | Breast cancer | Phosphorylation | 33051597 |
S | 213 | U | Prostate cancer | Phosphorylation | 36536346 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.