Id: | acc4254 |
Group: | 1sens |
Protein: | p38 MAPK |
Gene Symbol: | Mapk14 |
Protein Id: | P47811 |
Protein Name: | MK14_MOUSE |
PTM: | phosphorylation |
Site: | Thr180 |
Site Sequence: | LARHTDDEMTGYVATRWYRAP |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Diabetes Mellitus |
Disease Subtype: | Blood-testis barrier |
Disease Cellline: | |
Disease Info: | |
Drug: | Betaine |
Drug Info: | Betaine is a naturally occurring compound often used as a dietary supplement and has various physiological functions in the human body. |
Relation: |
p38 MAPK-Thr180
DOWN
+
Betaine
➜
Diabetes Mellitus
Alleviate
|
Effect: | modulate |
Effect Info: | BET exerts a protective effect on BTB dysfunction caused by diabetes by regulating the oxidative stress-mediated p38 MAPK pathway (with a significant downregulation of phosphorylation expression). |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 31585299 |
Sentence Index: | 31585299_9 |
Sentence: | "In addition, our data also showed a marked down-regulated the expressions of p38 MAPK phosphorylation and up-regulation the protein expressions of ZO-1, Occludin, Claudin-11, N-cadherin, and Connexin-43 after BET administration compared with the diabetic group." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.