Id: | acc4181 |
Group: | 1sens |
Protein: | p38 |
Gene Symbol: | MAPK14 |
Protein Id: | Q16539 |
Protein Name: | MK14_HUMAN |
PTM: | phosphorylation |
Site: | Thr180 |
Site Sequence: | LARHTDDEMTGYVATRWYRAP |
Disease Category: | Nervous system diseases |
Disease: | Alzheimer's Disease |
Disease Subtype: | |
Disease Cellline: | SH-SY5Y |
Disease Info: | |
Drug: | VB-037 |
Drug Info: | VB-037 is a drug with potential therapeutic applications. |
Relation: |
VB-037
➜
p38-Thr180
DOWN
➜
Alzheimer's Disease
Alleviate
|
Effect: | modulate |
Effect Info: | "VB-037 reduces neuroinflammation by inhibiting the phosphorylation and activation of p38, JNK. " |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 30707915 |
Sentence Index: | 30707915_1 |
Sentence: | "The pathogenesis of Alzheimer's disease (AD) is involved in the aggregation of misfolded amyloid beta (Abeta), which upregulates the activity of acetylcholinesterase (AChE), increases the production of reactive oxygen species (ROS), enhances neuroinflammation, and eventually leads to neuronal death." |
Sequence & Structure:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MAPK14 | ARRY-797 | MAP kinase p38 alpha inhibitor | 3 | Terminated | dilated cardiomyopathy | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Completed | acute coronary syndrome | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Terminated | COVID-19 | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 3 | Active, not recruiting | Facioscapulohumeral dystrophy | ClinicalTrials |
MAPK14 | ACUMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials |
MAPK14 | SEMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | Crohn's disease | ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | PF-03715455 | MAP kinase p38 alpha inhibitor | 2 | Terminated | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | AZD-7624 | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials |
MAPK14 | SEMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Terminated | Crohn's disease | ClinicalTrials |
MAPK14 | PH-797804 | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | chronic obstructive pulmonary disease | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
MAPK14 | ARRY-797 | MAP kinase p38 alpha inhibitor | 2 | Completed | dilated cardiomyopathy | ClinicalTrials ClinicalTrials |
MAPK14 | DORAMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Terminated | rheumatoid arthritis | ClinicalTrials |
MAPK14 | LOSMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | BMS-582949 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | DORAMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | psoriasis | ClinicalTrials |
MAPK14 | BMS-582949 | MAP kinase p38 alpha inhibitor | 2 | Completed | psoriasis | ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | PG-760564 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | TAK-715 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials |
MAPK14 | TALMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | PH-797804 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | VX-702 | MAP kinase p38 alpha inhibitor | 2 | Completed | rheumatoid arthritis | ClinicalTrials ClinicalTrials |
MAPK14 | DILMAPIMOD | MAP kinase p38 alpha inhibitor | 2 | Completed | coronary artery disease | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACMAPK14-Thr180 | |
---|---|
Cancer | Intensity |
BRCA | 2.28 |
COAD | 0.452 |
HGSC | -1.055 |
ccRCC | -0.189 |
GBM | -0.187 |
HNSC | 0.188 |
LUAD | 0.929 |
LUSC | 0.063 |
non_ccRCC | -0.898 |
PDAC | -0.317 |
UCEC | -1.265 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
T | 180 | P | Lung cancer/carcinoma | Phosphorylation | 22348039 |
T | 180 | U | Bladder cancer | Phosphorylation | 33204153 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.