Id: | acc4170 |
Group: | 1sens |
Protein: | p65 |
Gene Symbol: | Rela |
Protein Id: | P58546 |
Protein Name: | MTPN_HUMAN |
PTM: | phosphorylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Immune system diseases |
Disease: | Inflammatory |
Disease Subtype: | LPS induced |
Disease Cellline: | RAW264.7 |
Disease Info: | |
Drug: | Prethanol extract of Trifolium pratense |
Drug Info: | "Prethanol extract of Trifolium pratense is a botanical extract derived from Trifolium pratense, which may potentially have certain biological activities." |
Relation: |
Prethanol extract of Trifolium pratense
➜
p65-unclear
DOWN
➜
Inflammatory
Alleviate
|
Effect: | modulate |
Effect Info: | 40% PeTP reduces carrageenan-induced limb edema by inhibiting the activation of NF–κB and MAPK pathways. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 30320514 |
Sentence Index: | 30320514_3 |
Sentence: | "Pretreatment with 40% PeTP significantly inhibited the LPS-induced expression of nitric oxide (NO), prostaglandin E2 (PGE2), inducible nitric oxide synthase (iNOS), cyclooxygenase-2 (COX-2), and inflammatory cytokines, including tumour necrosis factor (TNF)-alpha, interleukin (IL)-1beta, and IL-6 in RAW264.7 cells, without inducing cytotoxicity." |
Sequence & Structure:
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.