Id: | acc4116 |
Group: | 1sens |
Protein: | HSP27 |
Gene Symbol: | Hspb1 |
Protein Id: | P42930 |
Protein Name: | HSPB1_RAT |
PTM: | phosphorylation |
Site: | Ser85 |
Site Sequence: | AFSRALNRQLSSGVSEIRQTA |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Cerebral Ischemia |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | KU–55933 |
Drug Info: | KU–55933 is a specific drug. It may be used in relevant medical research or treatment. |
Relation: |
KU–55933
➜
HSP27-Ser85
DOWN
➜
Cerebral Ischemia
Alleviate
|
Effect: | modulate |
Effect Info: | The activation of G6PD through ATM kinase-mediated HSP27 phosphorylation may be part of the endogenous antioxidant defense neuroprotective mechanism activated during ischemia-reperfusion. The ATM kinase inhibitor KU–55933 can reduce HSP27 phosphorylation and increase the infarct size. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 29510140 |
Sentence Index: | 29510140_0 |
Sentence: | Pentose phosphate pathway activation via HSP27 phosphorylation by ATM kinase: A putative endogenous antioxidant defense mechanism during cerebral ischemia-reperfusion. |
Sequence & Structure:
MTERRVPFSLLRSPSWEPFRDWYPAHSRLFDQAFGVPRFPDEWSQWFSSAGWPGYVRPLPAATAEGPAAVTLARPAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAEITIPVTFEARAQIGGPESEQSGAK
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.