Id: | acc4064 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63086 |
Protein Name: | MK01_RAT |
PTM: | phosphorylation |
Site: | Thr185 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Cardiac Fibrosis |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Eplerenone |
Drug Info: | Eplerenone is a medication used to treat high blood pressure and heart failure. It works by blocking the effects of aldosterone in the body. |
Relation: |
Eplerenone
➜
ERK2-Thr185
DOWN
➜
Cardiac Fibrosis
Alleviate
|
Effect: | modulate |
Effect Info: | Eplerenone blocks the expression of downstream 11beta - HSD1 and collagen I by inhibiting isoproterenol - induced phosphorylation of ERK1/2. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 28966243 |
Sentence Index: | 28966243_10 |
Sentence: | "Eplerenone inhibited isoproterenol-induced ERK1/2 phosphorylation and expression of 11beta-HSD1 and collagen-I in primary CFs, as well as the progression of cardiac fibrosis in the left ventricle." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.