Id: | acc4051 |
Group: | 1sens |
Protein: | YAP |
Gene Symbol: | Yap1 |
Protein Id: | Q2EJA0 |
Protein Name: | YAP1_RAT |
PTM: | phosphorylation |
Site: | Ser127 |
Site Sequence: | QLGAGTLTASGVVSGPAATPA |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Ventricular Cardiomyocytes |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Verteporfin |
Drug Info: | "Verteporfin is a drug, though the ""(?)"" indicates there may be some uncertainty about relevant details." |
Relation: |
Verteporfin
➜
YAP-Ser127
DOWN
➜
Ventricular Cardiomyocytes
Alleviate
|
Effect: | modulate |
Effect Info: | "Dephosphorylation (PTM) at serine 127 of Yap-1 drives cardiomyocyte cell cycle re-entry during embryonic heart development (Disease) by promoting nestin expression. This mechanism is blocked by Verteporfin (Drug), which inhibits the interaction between Yap-1 and TEAD, confirming that Yap-1 is a key regulatory factor upstream of nestin." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 28834610 |
Sentence Index: | 28834610_6 |
Sentence: | "Phorbol 12,13-dibutyrate treatment of neonatal rat ventricular cardiomyocytes increased Yap-1 phosphorylation and co-administration of the p38 MAPK inhibitor SB203580 led to significant dephosphorylation." |
Sequence & Structure:
MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAGTLTASGVVSGPAATPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQLNVPTSASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKTTSWLDPRLDPRFAMNQRITQSAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQLQMEKERLRLKQQELFRQELALRSQLPSLEQDGGTQNAVSSPGMTQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSIPRTPDDFLNSVDEMDTGDTISQSTLPSQQSRFPDYLEALPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSEILDVESVLAATKLDKESFLTWL
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.