Id: | acc4002 |
Group: | 1sens |
Protein: | GSK3beta |
Gene Symbol: | Gsk3b |
Protein Id: | P18266 |
Protein Name: | GSK3B_RAT |
PTM: | phosphorylation |
Site: | Ser9 |
Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Cerebral Ischemia |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Wortmannin |
Drug Info: | Wortmannin is a fungal metabolite that is a potent and specific inhibitor of phosphoinositide 3 - kinases. |
Relation: |
Wortmannin
➜
GSK3beta-Ser9
DOWN
➜
Cerebral Ischemia
Alleviate
|
Effect: | modulate |
Effect Info: | "ME-induced cerebral ischemia upregulates the phosphorylation of Akt and GSK-3beta, while Wortmannin can reverse this process." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 27866373 |
Sentence Index: | 27866373_8 |
Sentence: | Treatment with a phosphatidylinositol 3-kinase (PI3-K) inhibitor decreased the cerebral ischemia-induced phosphorylation of Akt and that of GSK-3beta at its Ser9. |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.