Id: | acc3952 |
Group: | 1sens |
Protein: | PPARgamma |
Gene Symbol: | Pparg |
Protein Id: | P37238 |
Protein Name: | PPARG_MOUSE |
PTM: | sulfhydration |
Site: | Cys139 |
Site Sequence: | PSNSLMAIECRVCGDKASGFH |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Obese |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | H2S |
Drug Info: | "H2S is hydrogen sulfide, a colorless, flammable gas with a characteristic rotten - egg odor and it has potential therapeutic applications in medical research." |
Relation: |
H2S
➜
PPARgamma-Cys139
UP
➜
Obese
Alleviate
|
Effect: | modulate |
Effect Info: | "H2S treatment enhanced the sulfhydration modification of PPARgamma, improved insulin resistance, but did not lead to an aggravation of obesity." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 26946260 |
Sentence Index: | 26946260_12 |
Sentence: | "In obese mice fed an HFD for 13 weeks, H2S treatment increased PPARgamma sulfhydration in adipose tissues and attenuated insulin resistance but did not increase obesity." |
Sequence & Structure:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | D | Hypercholesterolemia | Acetylation | 36453279 |
- | - | D | Atherosclerosis | Acetylation | 36453279 |
S | 112 | D | Obesity | Phosphorylation | 18204460 |
S | 273 | U | Hepatitis | Phosphorylation | 30008738 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.