Id: | acc3934 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | Smad3 |
Protein Id: | P84025 |
Protein Name: | SMAD3_RAT |
PTM: | phosphorylation |
Site: | Ser425 |
Site Sequence: | SPSIRCSSVS----------- |
Disease Category: | Systemic diseases |
Disease: | Peritoneal Fibrosis |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Gefitinib |
Drug Info: | "Gefitinib is an oral, selective epidermal growth factor receptor tyrosine kinase inhibitor (EGFR-TKI) used in the treatment of certain types of non - small cell lung cancer." |
Relation: |
Gefitinib
➜
Smad3-Ser425
DOWN
➜
Peritoneal Fibrosis
Alleviate
|
Effect: | modulate |
Effect Info: | "Gefitinib significantly inhibited the phosphorylation of EGFR, Smad3, STAT3, and NF–κB during fibrosis, reduced the overproduction of TGF–beta1 and pro - inflammatory cytokines, alleviated macrophage infiltration, and decreased angiogenesis and the increase of related cells after injury." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 26677863 |
Sentence Index: | 26677863_7 |
Sentence: | "Finally, gefitinib also attenuated high glucose-induced peritoneal fibrosis in rats and abrogated TGF-beta1-induced phosphorylation of Smad3 and the epithelial-to-mesenchymal transition of cultured human peritoneal mesothelial cells." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.