Id: acc3922
Group: 1sens
Protein: GSK3beta
Gene Symbol: Gsk3b
Protein Id: P18266
Protein Name: GSK3B_RAT
PTM: phosphorylation
Site: Ser9
Site Sequence: -MSGRPRTTSFAESCKPVQQP
Disease Category: Cardiovascular and circulatory system diseases
Disease: Myocardial I/R Injury
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: Remifentanil
Drug Info: Remifentanil is a potent opioid analgesic used for the induction and maintenance of anesthesia. It has a rapid onset and short duration of action.
Relation:
Remifentanil
GSK3beta-Ser9 DOWN
Myocardial I/R Injury Alleviate
Effect: modulate
Effect Info: Remifentanil preconditioning exerts a protective effect against myocardial ischemia-reperfusion injury by increasing the phosphorylation of STAT3 at Tyr705 and the phosphorylation of GSK-3beta.
Note:
Score: 4.0
Pubmed(PMID): 26468894
Sentence Index:
Sentence:

Sequence & Structure:

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDMWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: