Id: acc3908
Group: 1sens
Protein: GSK3
Gene Symbol: Gsk3a
Protein Id: Q2NL51
Protein Name: GSK3A_MOUSE
PTM: phosphorylation
Site: Ser9
Site Sequence: -MSGGGPSGGGPGGSGRARTS
Disease Category: Endocrine and metabolic diseases
Disease: Diabetes Mellitus
Disease Subtype: type 2 diabetic
Disease Cellline:
Disease Info:
Drug: Irisin
Drug Info: "Irisin is a myokine that has been linked to various physiological processes, including energy metabolism and bone health."
Relation:
Irisin
GSK3-Ser9 UP
Diabetes Mellitus Alleviate
Effect: modulate
Effect Info: "In diabetic mice, continuous subcutaneous infusion of Irisin can improve insulin sensitivity, reduce fasting blood glucose levels, increase the phosphorylation levels of GSK3 and Akt, glycogen content, and Irisin levels, and inhibit the phosphorylation of GS and the expression of PEPCK and G6Pase in the liver. "
Note:
Score: 4.0
Pubmed(PMID): 26201094
Sentence Index:
Sentence:

Sequence & Structure:

MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPSGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATVGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLITPIIYIKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSSKTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRRLGAQLPNDRPLPPLFNFSPGELSIQPSLNAILIPPHLRSPAGPASPLTTSYNPSSQALTEAQTGQDWQPSDATTATLASSS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: