Id: | acc3902 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63086 |
Protein Name: | MK01_RAT |
PTM: | phosphorylation |
Site: | Thr185 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Vascular Dysfunction |
Disease Subtype: | Diabetes Mellitus |
Disease Cellline: | |
Disease Info: | |
Drug: | Lapatinib |
Drug Info: | Lapatinib is a medication used in the treatment of certain types of breast cancer. It works by inhibiting specific proteins involved in cancer cell growth. |
Relation: |
Lapatinib
➜
ERK2-Thr185
DOWN
➜
Vascular Dysfunction
Alleviate
|
Effect: | modulate |
Effect Info: | "Lapatinib treatment also significantly attenuated the increased phosphorylation levels of EGFR, ErbB2, ERK1/2, AKT, ROCK2, and IkB - alpha induced by diabetes, and normalized the reduced levels of phosphorylated FOXO3A and eNOS (Ser1177) in diabetic MVBs. " |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 26114862 |
Sentence Index: | 26114862_4 |
Sentence: | "Chronic in vivo or acute ex vivo Lapatinib treatment also significantly attenuated diabetes-induced increases in phosphorylation of EGFR, ErbB2, ERK1/2, AKT, ROCK2 and IkB-alpha as well as normalized the reduced levels of phosphorylated FOXO3A, and eNOS (Ser1177) in the diabetic MVB." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.