Id: acc3860
Group: 1sens
Protein: Smad3
Gene Symbol: Smad3
Protein Id: P84025
Protein Name: SMAD3_RAT
PTM: phosphorylation
Site: Ser423
Site Sequence: MGSPSIRCSSVS---------
Disease Category: Urinary and reproductive system diseases
Disease: Fibrosis
Disease Subtype: unilateral ureteral obstruction
Disease Cellline: HK-2
Disease Info:
Drug: ATM KO
Drug Info: "ATM KO is a drug, but specific information about it is not provided, and its properties and uses remain unknown."
Relation:
ATM KO
Smad3-Ser423 DOWN
Fibrosis Alleviate
Effect: modulate
Effect Info: "In a unilateral ureteral obstruction mouse model, ATM activation increased fourfold and was associated with the phosphorylation of SMAD3 and p53. Stable silencing or pharmacological inhibition of ATM with KU - 55933 significantly reduced TGF–beta1 - induced p55 activation and the expression of fibrotic markers."
Note: Non-conventional drugs
Score: 3.0
Pubmed(PMID): 25480384
Sentence Index:
Sentence:

Sequence & Structure:

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: