Id: acc3859
Group: 1sens
Protein: Smad3
Gene Symbol: Smad3
Protein Id: Q8BUN5
Protein Name: SMAD3_MOUSE
PTM: phosphorylation
Site: Ser425
Site Sequence: SPSIRCSSVS-----------
Disease Category: Urinary and reproductive system diseases
Disease: Fibrosis
Disease Subtype: unilateral ureteral obstruction
Disease Cellline: UUO model
Disease Info:
Drug: KU-55933
Drug Info: "KU-55933 is a drug, which may have specific pharmacological effects and applications in medical research."
Relation:
KU-55933
Smad3-Ser425 DOWN
Fibrosis Alleviate
Effect: modulate
Effect Info: "In the unilateral ureteral obstruction mouse model, ATM activation increased fourfold and was associated with the phosphorylation of SMAD3 and p53. Stable silencing or pharmacological inhibition of ATM with KU - 55933 significantly reduced TGF–beta1 - induced p56 activation and the expression of fibrosis markers."
Note:
Score: 4.0
Pubmed(PMID): 25480384
Sentence Index:
Sentence:

Sequence & Structure:

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 204 D Obesity Phosphorylation 29700281
- - D Chronic kidney disease Phosphorylation 23264657

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: