Id: | acc3829 |
Group: | 1sens |
Protein: | cav-1 |
Gene Symbol: | Cav1 |
Protein Id: | P41350 |
Protein Name: | CAV1_RAT |
PTM: | phosphorylation |
Site: | Tyr14 |
Site Sequence: | KYVDSEGHLYTVPIREQGNIY |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Diabetes Mellitus |
Disease Subtype: | Diabetic Nephropathy |
Disease Cellline: | |
Disease Info: | |
Drug: | Curcumin |
Drug Info: | "Curcumin is a natural polyphenol compound derived from the rhizomes of Curcuma plants, known for its anti - inflammatory and antioxidant properties." |
Relation: |
Curcumin
➜
cav-1-Tyr14
DOWN
➜
Diabetes Mellitus
Aggravate
|
Effect: | modulate |
Effect Info: | Curcumin inhibits the high glucose-induced inflammatory response and improves the pathological damage of renal tissue by inhibiting the phosphorylation of Caveolin-1 at Tyr14 and blocking its function of activating TLR4. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 25196431 |
Sentence Index: | 25196431_7 |
Sentence: | "In vivo, curcumin improved histological abnormalities and fibrosis of a diabetic kidney, inhibited renal inflammatory gene expression and reduced cav-1 phosphorylation at Tyr(14) and the expression of TLR4." |
Sequence & Structure:
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.