Id: | acc3827 |
Group: | 1sens |
Protein: | YAP |
Gene Symbol: | YAP1 |
Protein Id: | P46937 |
Protein Name: | YAP1_HUMAN |
PTM: | phosphorylation |
Site: | Ser127 |
Site Sequence: | LTPQHVRAHSSPASLQLGAVS |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Hypertrophic cardiomyopathy |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | YAP OE |
Drug Info: | YAP OE is a drug. It may play a specific role in relevant medical or biological processes. |
Relation: |
YAP OE
➜
YAP-Ser127
UP
➜
Hypertrophic cardiomyopathy
Aggravate
|
Effect: | modulate |
Effect Info: | "YAP dephosphorylation (Ser127) and Akt1/FOXO3 phosphorylation (Ser473/Thr32) activate YAP transcriptional activity by suppressing MST1 expression, thereby promoting the development of HCM." |
Note: | Non-conventional drugs |
Score: | 3.0 |
Pubmed(PMID): | 25168380 |
Sentence Index: | 25168380_3 |
Sentence: | "In this study, we demonstrated an up-regulation of YAP mRNA and protein levels in both HCM patient samples and transverse aortic constriction murine models as well as reduced phosphorylation of YAP at serine 127 accompanied by increased transcription of YAP-mediated genes in hypertrophic heart tissues." |
Sequence & Structure:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACYAP1-Ser127 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | 0.729 |
HGSC | -1.387 |
ccRCC | |
GBM | |
HNSC | 0.735 |
LUAD | -0.077 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 127 | A | Hepatocellular carcinoma/hepatocarcinoma/hepatoma | Phosphorylation | 22761457 |
S | 127 | A | Adult T-cell leukemia/lymphoma | Phosphorylation | 35210364 |
S | 127 | D | Bladder cancer | Phosphorylation | 26119935 |
S | 127 | D | Glioblastoma | Phosphorylation | 34343153 |
S | 127 | D | Prostate cancer | Phosphorylation | 36823643 |
S | 127 | D | Lung cancer/carcinoma | Phosphorylation | 21060948 |
S | 127 | D | Renal cell carcinoma | Phosphorylation | 32926756 |
S | 127 | D | Liver cancer | Phosphorylation | 28474680 |
S | 127 | D | Diabetes mellitus | Phosphorylation | 28474680 |
S | 127 | D | Coronary artery disease | Phosphorylation | 37104914 |
S | 127 | P | Cervical cancer/carcinoma | Phosphorylation | 23027127 |
S | 127 | P | Hepatocellular cancer | Phosphorylation | 35597479 |
S | 127 | P | Colon cancer | Phosphorylation | 34206989 |
S | 127 | U | Hepatocellular cancer | Phosphorylation | 35586495 |
S | 127 | U | Parkinson's disease | Phosphorylation | 32929029 |
S | 127 | U | Osteoarthritis | Phosphorylation | 37100374 |
S | 127 | U | Breast cancer | Phosphorylation | 36774339 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.