| Id: | acc3775 |
| Group: | 1sens |
| Protein: | GSK3beta |
| Gene Symbol: | Gsk3b |
| Protein Id: | Q9WV60 |
| Protein Name: | GSK3B_MOUSE |
| PTM: | phosphorylation |
| Site: | Ser9 |
| Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Cardiac Contractile Dysfunction |
| Disease Subtype: | Akt2-knockout murine model of insulin resistance |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | H2S |
| Drug Info: | "H2S is hydrogen sulfide, a colorless, flammable gas with a characteristic rotten - egg odor and it has potential therapeutic applications in medical research." |
| Relation: |
H2S
➜
GSK3beta-Ser9
UP
➜
Cardiac Contractile Dysfunction
Alleviate
|
| Effect: | modulate |
| Effect Info: | "H2S improves the phenomenon of decreased phosphorylation levels of PTEN, Akt, and GSK3beta in disease model mice, alleviating mitochondrial damage and cell apoptosis." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 24622975 |
| Sentence Index: | 24622975_7 |
| Sentence: | "Furthermore, Akt2 knockout displayed upregulated apoptotic protein markers (Bax, caspase-3, caspase-9, and caspace-12) and mitochondrial damage (reduced aconitase activity and NAD(+), elevated cytochrome-c release from mitochondria) along with reduced phosphorylation of PTEN, Akt, and GSK3beta in the absence of changes in pan protein expression, the effects of which were abolished or significantly ameliorated by H2S treatment." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
