Id: | acc3737 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63085 |
Protein Name: | MK01_MOUSE |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HTGFLTEYVATRWYRAPEIML |
Disease Category: | Nervous system diseases |
Disease: | Axonal Degeneration |
Disease Subtype: | optic nerve injury |
Disease Cellline: | |
Disease Info: | |
Drug: | Brimonidine |
Drug Info: | Brimonidine is a medication commonly used to treat open - angle glaucoma and ocular hypertension. It helps to lower the pressure inside the eyes. |
Relation: |
Brimonidine
➜
ERK2-Tyr187
UP
➜
Axonal Degeneration
Alleviate
|
Effect: | modulate |
Effect Info: | Brimonidine promotes axon regeneration by facilitating the phosphorylation of Erk and activating relevant signaling pathways. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 23928702 |
Sentence Index: | 23928702_0 |
Sentence: | Brimonidine promotes axon growth after optic nerve injury through Erk phosphorylation. |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | D | EL4 thymoma | Phosphorylation | 10753946 |
T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.