Id: acc3719
Group: 1sens
Protein: PPARgamma
Gene Symbol: Pparg
Protein Id: P37238
Protein Name: PPARG_MOUSE
PTM: phosphorylation
Site: Ser273
Site Sequence: ILTGKTTDKSPFVIYDMNSLM
Disease Category: Endocrine and metabolic diseases
Disease: Diabetes Mellitus
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: C333H
Drug Info: "C333H is a drug with a chemical formula of C333H, which may have specific pharmacological properties and potential medical applications."
Relation:
C333H
PPARgamma-Ser273 DOWN
Diabetes Mellitus Alleviate
Effect: modulate
Effect Info: "C333H can increase the level of high - molecular - weight adiponectin isoforms in the circulation, reduce the phosphorylation of serine at position 273 of PPARgamma in brown adipose tissue, and improve insulin resistance."
Note:
Score: 4.0
Pubmed(PMID): 23563593
Sentence Index:
Sentence:

Sequence & Structure:

MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 273 U Hepatitis Phosphorylation 30008738

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: