| Id: | acc3662 |
| Group: | 1sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63086 |
| Protein Name: | MK01_RAT |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Myocardial Fibrosis |
| Disease Subtype: | DOCA induced |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Aliskiren |
| Drug Info: | "Aliskiren (ALI), a new rennin inhibitor, can not only lower the blood pressure, but improve the myocardial fibrosis and subsequent remodeling via its anti-inflammatory and anti-oxidative effects." |
| Relation: |
Aliskiren
➜
ERK2-unclear
DOWN
➜
Myocardial Fibrosis
Alleviate
|
| Effect: | modulate |
| Effect Info: | "ALI can inhibit DOCA-induced myocardial fibrosis, which is unrelated to its antihypertensive effect. This may be related to the inhibition of RA and Ang II production, the inhibition of ERK1/2 phosphorylation, and the expression of MMP9 in the heart." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 22642589 |
| Sentence Index: | 22642589_10 |
| Sentence: | "ALI can inhibit the DOCA induced myocardial fibrosis independent of its pressure-lowing effect, which may be related to the suppression of RA and Ang II production, inhibition of ERK1/2 phosphorylation and MMP9 expression in the heart." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | A | Basophilic leukemia | Phosphorylation | 11971018 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
