Id: acc3645
Group: 1sens
Protein: p47phox
Gene Symbol: Ncf1
Protein Id: Q09014
Protein Name: NCF1_MOUSE
PTM: phosphorylation
Site: Ser
Site Sequence:
Disease Category: Nervous system diseases
Disease: Cognitive Abnormalities
Disease Subtype: Cognitive Deficits
Disease Cellline:
Disease Info:
Drug: Domoic acid
Drug Info: Domoic acid is a neurotoxin produced by certain marine algae. It can cause amnesic shellfish poisoning in humans when consumed through contaminated shellfish.
Relation:
Domoic acid
p47phox-Ser UP
Cognitive Abnormalities Aggravate
Effect: modulate
Effect Info: "Kainic acid promotes the phosphorylation of p47phox by activating PKC-ζ, which in turn activates the phosphorylation of JNK and inhibits the phosphorylation of FoxO1, ultimately leading to neuronal apoptosis and cognitive deficits."
Note:
Score: 4.0
Pubmed(PMID): 22474074
Sentence Index:
Sentence:

Sequence & Structure:

MGDTFIRHIALLGFEKRFIPSQHYVYMFLVKWQDLSEKVVYRKFTEIYEFHKMLKEMFPIEAGEIHTENRVIPHLPAPRWFDGQRAAESRQGTLTEYFNGLMGLPVKISRCPHLLDFFKVRPDDLKLPTDSQAKKPETYLVPKDGKNNVADITGPIILQTYRAIADYEKSSGTEMTVATGDVVDVVEKSESGWWFCQMKTKRGWVPASYLEPLDSPDEAEDPDPNYAGEPYVTIKAYAAVEEDEMSLSEGEAIEVIHKLLDGWWVVRKGDITGYFPSMYLQKAGEEITQAQRQIRGRGAPPRRSTIRNAQSIHQRSRKRLSQDTYRRNSVRFLQQRRRPGRPGPLSTDGTKDNPSTPRVKPQPAVPPRPSSDLILHRCTESTKRKLTSAV

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD

No data.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: